Lineage for d2a06w_ (2a06 W:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457317Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1457318Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1457319Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 1457330Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
    Uniprot P00130
  8. 1457332Domain d2a06w_: 2a06 W: [125937]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_
    automated match to d1be3j_
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06w_

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (W:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d2a06w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06w_ f.23.14.1 (W:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOPe Domain Coordinates for d2a06w_:

Click to download the PDB-style file with coordinates for d2a06w_.
(The format of our PDB-style files is described here.)

Timeline for d2a06w_: