![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries) Uniprot P00130 |
![]() | Domain d2a06w1: 2a06 W:1-61 [125937] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06d1, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06q1, d2a06q2, d2a06s1, d2a06t1, d2a06u1 automatically matched to d1be3j_ complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOP Domain Sequences for d2a06w1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06w1 f.23.14.1 (W:1-61) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye n
Timeline for d2a06w1: