SCOPe 2.04: Domain d2a06u_: 2a06 U:

Lineage for d2a06u_ (2a06 U:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186764] (6 PDB entries)

8. Domain d2a06u_: 2a06 U: [125936]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06v_, d2a06w_
   automated match to d1l0lh_
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06u_

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (U:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d2a06u_:

Sequence; same for both SEQRES and ATOM records:

>d2a06u_ f.28.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
lfnslk

Timeline for d2a06u_:

• d2a06u_ first appeared in SCOP 1.73, called d2a06u1
  
• d2a06u_ appears in SCOPe 2.03
  
• d2a06u_ appears in SCOPe 2.05
  
• d2a06u_ appears in the current release, SCOPe 2.08