![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries) Uniprot P00126 |
![]() | Domain d2a06u1: 2a06 U:13-78 [125936] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06d1, d2a06d2, d2a06f1, d2a06g1, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06q1, d2a06q2, d2a06s1, d2a06t1, d2a06w1 automatically matched to d1l0lh_ complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOP Domain Sequences for d2a06u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06u1 f.28.1.1 (U:13-78) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk lfnslk
Timeline for d2a06u1: