| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) ![]() |
| Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
| Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries) Uniprot P00125 |
| Domain d2a06q2: 2a06 Q:196-241 [125933] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06d1, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06q1, d2a06s1, d2a06t1, d2a06u1, d2a06w1 automatically matched to d1be3d3 complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOP Domain Sequences for d2a06q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06q2 f.23.11.1 (Q:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk
Timeline for d2a06q2: