Lineage for d2a06q1 (2a06 Q:1-195)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 634162Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 634163Protein Cytochrome bc1 domain [46677] (3 species)
  7. 634175Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
  8. 634179Domain d2a06q1: 2a06 Q:1-195 [125932]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06q2, d2a06s1, d2a06t1, d2a06u1, d2a06w1
    automatically matched to d1be3d2
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06q1

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (Q:) Cytochrome c1, heme protein, mitochondrial

SCOP Domain Sequences for d2a06q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06q1 a.3.1.3 (Q:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d2a06q1:

Click to download the PDB-style file with coordinates for d2a06q1.
(The format of our PDB-style files is described here.)

Timeline for d2a06q1: