Lineage for d2a06o1 (2a06 O:18-235)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739191Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 739258Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 739272Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)
  8. 739275Domain d2a06o1: 2a06 O:18-235 [125930]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06d1, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06q1, d2a06q2, d2a06s1, d2a06t1, d2a06u1, d2a06w1
    automatically matched to d1bccb1
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06o1

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (O:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial

SCOP Domain Sequences for d2a06o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06o1 d.185.1.1 (O:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt
kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev
aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn
hftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d2a06o1:

Click to download the PDB-style file with coordinates for d2a06o1.
(The format of our PDB-style files is described here.)

Timeline for d2a06o1: