![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries) |
![]() | Domain d2a06o1: 2a06 O:18-235 [125930] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06d1, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06q1, d2a06q2, d2a06s1, d2a06t1, d2a06u1, d2a06w1 automatically matched to d1bccb1 complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOP Domain Sequences for d2a06o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06o1 d.185.1.1 (O:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn hftsarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d2a06o1: