SCOP 1.73: Domain d2a06d2: 2a06 D:196-241

Lineage for d2a06d2 (2a06 D:196-241)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)

8. Domain d2a06d2: 2a06 D:196-241 [125924]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06d1, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06q1, d2a06s1, d2a06t1, d2a06u1, d2a06w1
   automatically matched to d1be3d3
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06d2

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOP Domain Sequences for d2a06d2:

Sequence; same for both SEQRES and ATOM records:

>d2a06d2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d2a06d2:

• d2a06d2 is new in SCOP 1.73
  
• d2a06d2 appears in SCOP 1.75
  
• d2a06d2 appears in the current release, SCOPe 2.08