Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein) |
Protein Cytochrome bc1 domain [46677] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries) Uniprot P00125 |
Domain d2a06d1: 2a06 D:1-195 [125923] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06d2, d2a06f1, d2a06g1, d2a06h1, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06q2, d2a06s1, d2a06t1, d2a06u1, d2a06w1 automatically matched to d1be3d2 complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOP Domain Sequences for d2a06d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06d1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]} sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms qvakdvctflrwaae
Timeline for d2a06d1: