Lineage for d2a06b2 (2a06 B:236-439)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444881Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1444882Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1444883Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1444958Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 1444987Species Cow (Bos taurus) [TaxId:9913] [56000] (18 PDB entries)
    Uniprot P23004
  8. 1444989Domain d2a06b2: 2a06 B:236-439 [125922]
    Other proteins in same PDB: d2a06a1, d2a06a2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_
    automated match to d1ppjb2
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06b2

PDB Entry: 2a06 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial

SCOPe Domain Sequences for d2a06b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a06b2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d2a06b2:

Click to download the PDB-style file with coordinates for d2a06b2.
(The format of our PDB-style files is described here.)

Timeline for d2a06b2: