Lineage for d1zy9a1 (1zy9 A:1-177)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664821Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins)
  6. 664822Protein Alpha-galactosidase GalA N-terminal domain [141175] (1 species)
    rudiment, partly refolded form of supersandwich fold
  7. 664823Species Thermotoga maritima [TaxId:2336] [141176] (1 PDB entry)
  8. 664824Domain d1zy9a1: 1zy9 A:1-177 [125813]
    Other proteins in same PDB: d1zy9a2
    complexed with edo, gol

Details for d1zy9a1

PDB Entry: 1zy9 (more details), 2.34 Å

PDB Description: Crystal structure of Alpha-galactosidase (EC 3.2.1.22) (Melibiase) (tm1192) from Thermotoga maritima at 2.34 A resolution
PDB Compounds: (A:) alpha-galactosidase

SCOP Domain Sequences for d1zy9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zy9a1 b.30.5.11 (A:1-177) Alpha-galactosidase GalA N-terminal domain {Thermotoga maritima [TaxId: 2336]}
meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn
nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski
ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna

SCOP Domain Coordinates for d1zy9a1:

Click to download the PDB-style file with coordinates for d1zy9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zy9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zy9a2