Lineage for d1zy2a1 (1zy2 A:1-136)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982189Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 982418Protein Transcriptional activator sigm54 (NtrC1), N-terminal domain [102230] (1 species)
  7. 982419Species Aquifex aeolicus [TaxId:63363] [102231] (2 PDB entries)
  8. 982422Domain d1zy2a1: 1zy2 A:1-136 [125811]
    complexed with mg

Details for d1zy2a1

PDB Entry: 1zy2 (more details), 3.03 Å

PDB Description: Crystal structure of the phosphorylated receiver domain of the transcription regulator NtrC1 from Aquifex aeolicus
PDB Compounds: (A:) transcriptional regulator NtrC1

SCOPe Domain Sequences for d1zy2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zy2a1 c.23.1.1 (A:1-136) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
lrkenellrrekdlke

SCOPe Domain Coordinates for d1zy2a1:

Click to download the PDB-style file with coordinates for d1zy2a1.
(The format of our PDB-style files is described here.)

Timeline for d1zy2a1: