SCOP 1.73: Domain d1zxia1: 1zxi A:85-156

Lineage for d1zxia1 (1zxi A:85-156)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (3 PDB entries)

8. Domain d1zxia1: 1zxi A:85-156 [125772]
   Other proteins in same PDB: d1zxia2, d1zxib1, d1zxib2, d1zxic1, d1zxic2, d1zxid2, d1zxif1, d1zxif2
   automatically matched to d1ffua1
   complexed with cu, cum, fad, fes, mcn, po4

Details for d1zxia1

PDB Entry: 1zxi, 1.7 Å

PDB Description: reconstituted co dehydrogenase from oligotropha carboxidovorans

PDB Compounds: (A:) Carbon monoxide dehydrogenase small chain

SCOP Domain Sequences for d1zxia1:

Sequence; same for both SEQRES and ATOM records:

>d1zxia1 a.56.1.1 (A:85-156) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
gtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctgyqn
ivkaiqyaaaki

Timeline for d1zxia1:

• d1zxia1 is new in SCOP 1.73
  
• d1zxia1 appears in SCOP 1.75
  
• d1zxia1 appears in the current release, SCOPe 2.08