Lineage for d1zwwb1 (1zww B:28-246)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780741Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 780742Superfamily a.238.1: BAR/IMD domain-like [103657] (4 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 780743Family a.238.1.1: BAR domain [103658] (3 proteins)
    sensor of membrane curvature
  6. 780750Protein Endophilin-1 [140699] (3 species)
    SH3-containing GRB2-like protein 2
  7. 780758Species Mouse (Mus musculus) [TaxId:10090] [140702] (1 PDB entry)
    Uniprot Q62420 27-246
  8. 780760Domain d1zwwb1: 1zww B:28-246 [125751]
    automatically matched to 1ZWW A:27-246
    complexed with cd

Details for d1zwwb1

PDB Entry: 1zww (more details), 2.3 Å

PDB Description: Crystal structure of endophilin-A1 BAR domain
PDB Compounds: (B:) sh3-containing grb2-like protein 2

SCOP Domain Sequences for d1zwwb1:

Sequence, based on SEQRES records: (download)

>d1zwwb1 a.238.1.1 (B:28-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
kldddfkemerkvdvtsravmeimtktieylqpnpasraklsmintmskirgqekgpgyp
qaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlh
dkdlreiqhhlkklegrrldfgykkkrqgkipdeelrqalekfdeskeiaessmfnllem
dieqvsqlsalvqaqleyhkqavqilqqvtvrleerirq

Sequence, based on observed residues (ATOM records): (download)

>d1zwwb1 a.238.1.1 (B:28-246) Endophilin-1 {Mouse (Mus musculus) [TaxId: 10090]}
kldddfkemerkvdvtsravmeimtktieylqpnpasrakpqaeallaeamlkfgrelgd
dcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkklegrrl
dfgykkkrdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
ilqqvtvrleerirq

SCOP Domain Coordinates for d1zwwb1:

Click to download the PDB-style file with coordinates for d1zwwb1.
(The format of our PDB-style files is described here.)

Timeline for d1zwwb1: