Lineage for d1zwic1 (1zwi C:86-119)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886689Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 886690Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 886691Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 886708Protein Potassium channel protein [56901] (2 species)
  7. 886709Species Streptomyces coelicolor [TaxId:1902] [56902] (28 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 886724Domain d1zwic1: 1zwi C:86-119 [125740]
    automatically matched to d1jq1a_
    complexed with dga, f09, k; mutant

Details for d1zwic1

PDB Entry: 1zwi (more details), 2.5 Å

PDB Description: structure of mutant kcsa potassium channel
PDB Compounds: (C:) Voltage-gated potassium channel

SCOP Domain Sequences for d1zwic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwic1 f.14.1.1 (C:86-119) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d1zwic1:

Click to download the PDB-style file with coordinates for d1zwic1.
(The format of our PDB-style files is described here.)

Timeline for d1zwic1: