Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (273 PDB entries) Uniprot P00698 |
Domain d1zvyb1: 1zvy B:1-129 [125734] Other proteins in same PDB: d1zvya1 automatically matched to d1lsg_1 complexed with gol, po4 |
PDB Entry: 1zvy (more details), 1.63 Å
SCOPe Domain Sequences for d1zvyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvyb1 d.2.1.2 (B:1-129) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1zvyb1: