SCOPe 2.05: Domain d1zvvg2: 1zvv G:60-332

Lineage for d1zvvg2 (1zvv G:60-332)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)

7. Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
   Uniprot P46828 58-322 ! Uniprot P46828

8. Domain d1zvvg2: 1zvv G:60-332 [125732]
   Other proteins in same PDB: d1zvva1, d1zvvb1, d1zvvg1, d1zvvj1, d1zvvp_, d1zvvw_
   automated match to d1zvva2
   protein/DNA complex; complexed with iod

Details for d1zvvg2

PDB Entry: 1zvv, 2.98 Å

PDB Description: Crystal structure of a ccpa-crh-dna complex

PDB Compounds: (G:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1zvvg2:

Sequence; same for both SEQRES and ATOM records:

>d1zvvg2 c.93.1.1 (G:60-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediasmykyniilsnsdqnqdkqlhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivelphriefrqstk

Timeline for d1zvvg2:

• d1zvvg2 first appeared in SCOP 1.73
  
• d1zvvg2 appears in SCOPe 2.04
  
• d1zvvg2 appears in SCOPe 2.06
  
• d1zvvg2 appears in the current release, SCOPe 2.08