SCOPe 2.02: Domain d1zvoa1: 1zvo A:3-108

Lineage for d1zvoa1 (1zvo A:3-108)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1zvoa1: 1zvo A:3-108 [125710]
   Other proteins in same PDB: d1zvoa2, d1zvob2
   automatically matched to d1adql1

Details for d1zvoa1

PDB Entry: 1zvo

PDB Description: semi-extended solution structure of human myeloma immunoglobulin d determined by constrained x-ray scattering

PDB Compounds: (A:) myeloma immunoglobulin D lambda

SCOPe Domain Sequences for d1zvoa1:

Sequence; same for both SEQRES and ATOM records:

>d1zvoa1 b.1.1.1 (A:3-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
vltqppsasgtpgqrvtiscfgsssnigryyvywyqqlpgttpklliykdnqrpsgvpdr
fsgsksgtsaslaisglrsedeadyycaawddslwvfgggttltvl

Timeline for d1zvoa1:

• d1zvoa1 first appeared in SCOP 1.73
  
• d1zvoa1 appears in SCOPe 2.01
  
• d1zvoa1 appears in SCOPe 2.03
  
• d1zvoa1 appears in the current release, SCOPe 2.08