SCOPe 2.08: Domain d1zunb2: 1zun B:330-434

Lineage for d1zunb2 (1zun B:330-434)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain [141345] (1 species)

7. Species Pseudomonas syringae pv. tomato [TaxId:323] [141346] (1 PDB entry)
   Uniprot Q87WW1 330-434

8. Domain d1zunb2: 1zun B:330-434 [125678]
   Other proteins in same PDB: d1zuna1, d1zuna2, d1zunb1, d1zunb3
   complexed with ags, gdp, mg, na

Details for d1zunb2

PDB Entry: 1zun, 2.7 Å

PDB Description: Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae

PDB Compounds: (B:) sulfate adenylate transferase, subunit 1/adenylylsulfate kinase

SCOPe Domain Sequences for d1zunb2:

Sequence; same for both SEQRES and ATOM records:

>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}
qvsdafdamlvwmaeepmlpgkkydikratsyvpgsiasithrvdvntleegpasslqln
eigrvkvsldapialdgyssnrttgafividrltngtvaagmiia

Timeline for d1zunb2:

• d1zunb2 first appeared in SCOP 1.73
  
• d1zunb2 appears in SCOPe 2.07