Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (14 species) |
Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry) Uniprot A2RLG8 6-173 |
Domain d1zujd_: 1zuj D: [125675] automated match to d1zuja1 |
PDB Entry: 1zuj (more details), 2.9 Å
SCOPe Domain Sequences for d1zujd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zujd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]} sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef
Timeline for d1zujd_: