SCOPe 2.01: Domain d1zucb_: 1zuc B:

Lineage for d1zucb_ (1zuc B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Progesterone receptor [48517] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries)
   Uniprot P06401 679-932

8. Domain d1zucb_: 1zuc B: [125667]
   automated match to d1a28a_
   complexed with so4, t98

Details for d1zucb_

PDB Entry: 1zuc, 2 Å

PDB Description: Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist tanaproget

PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d1zucb_:

Sequence; same for both SEQRES and ATOM records:

>d1zucb_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

Timeline for d1zucb_:

• d1zucb_ first appeared in SCOP 1.73, called d1zucb1
  
• d1zucb_ was called d1zucb1 in SCOP 1.75
  
• d1zucb_ appears in SCOPe 2.02
  
• d1zucb_ appears in the current release, SCOPe 2.08