SCOPe 2.06: Domain d1ztxe_: 1ztx E:

Lineage for d1ztxe_ (1ztx E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (7 species)
   not a true protein

7. Species West Nile virus [TaxId:11082] [186921] (2 PDB entries)

8. Domain d1ztxe_: 1ztx E: [125658]
   Other proteins in same PDB: d1ztxh1, d1ztxl1, d1ztxl2
   automated match to d1s6na_

Details for d1ztxe_

PDB Entry: 1ztx, 2.5 Å

PDB Description: West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab

PDB Compounds: (E:) envelope protein

SCOPe Domain Sequences for d1ztxe_:

Sequence; same for both SEQRES and ATOM records:

>d1ztxe_ b.1.18.4 (E:) automated matches {West Nile virus [TaxId: 11082]}
ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

Timeline for d1ztxe_:

• d1ztxe_ first appeared in SCOP 1.73, called d1ztxe1
  
• d1ztxe_ appears in SCOPe 2.05
  
• d1ztxe_ appears in SCOPe 2.07
  
• d1ztxe_ appears in the current release, SCOPe 2.08