Lineage for d1ztxe1 (1ztx E:300-400)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658925Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 658926Protein Envelope glycoprotein [49213] (5 species)
  7. 658956Species West Nile virus [TaxId:11082] [110056] (2 PDB entries)
  8. 658957Domain d1ztxe1: 1ztx E:300-400 [125658]
    Other proteins in same PDB: d1ztxh1
    automatically matched to d1s6na_

Details for d1ztxe1

PDB Entry: 1ztx (more details), 2.5 Å

PDB Description: West Nile Virus Envelope Protein DIII in complex with neutralizing E16 antibody Fab
PDB Compounds: (E:) envelope protein

SCOP Domain Sequences for d1ztxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztxe1 b.1.18.4 (E:300-400) Envelope glycoprotein {West Nile virus [TaxId: 11082]}
ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

SCOP Domain Coordinates for d1ztxe1:

Click to download the PDB-style file with coordinates for d1ztxe1.
(The format of our PDB-style files is described here.)

Timeline for d1ztxe1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ztxh1