SCOP 1.75: Domain d1zt9e1: 1zt9 E:5-105

Lineage for d1zt9e1 (1zt9 E:5-105)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (3 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (1 protein)
   intertwined dimer of identical 6-helical subunits

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (13 PDB entries)

8. Domain d1zt9e1: 1zt9 E:5-105 [125634]
   automatically matched to d1co0a_
   complexed with so4, trp

Details for d1zt9e1

PDB Entry: 1zt9, 2 Å

PDB Description: e. coli trp repressor, tetragonal crystal form

PDB Compounds: (E:) trp operon repressor

SCOP Domain Sequences for d1zt9e1:

Sequence; same for both SEQRES and ATOM records:

>d1zt9e1 a.4.12.1 (E:5-105) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
spysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg
emsqrelknelgagiatitrgsnslkaapvelrqwleevll

Timeline for d1zt9e1:

• d1zt9e1 first appeared in SCOP 1.73
  
• d1zt9e1 is called d1zt9e_ in SCOPe 2.01
  
• d1zt9e1 appears in the current release, SCOPe 2.08, called d1zt9e_