Lineage for d1zt9d1 (1zt9 D:5-105)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636178Superfamily a.4.12: TrpR-like [48295] (2 families) (S)
    contains an extra shared helix after the HTH motif
  5. 636179Family a.4.12.1: Trp repressor, TrpR [48296] (1 protein)
    intertwined dimer of identical 6-helical subunits
  6. 636180Protein Trp repressor, TrpR [48297] (1 species)
  7. 636181Species Escherichia coli [TaxId:562] [48298] (13 PDB entries)
  8. 636188Domain d1zt9d1: 1zt9 D:5-105 [125633]
    automatically matched to d1co0a_
    complexed with so4, trp

Details for d1zt9d1

PDB Entry: 1zt9 (more details), 2 Å

PDB Description: e. coli trp repressor, tetragonal crystal form
PDB Compounds: (D:) trp operon repressor

SCOP Domain Sequences for d1zt9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt9d1 a.4.12.1 (D:5-105) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
spysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg
emsqrelknelgagiatitrgsnslkaapvelrqwleevll

SCOP Domain Coordinates for d1zt9d1:

Click to download the PDB-style file with coordinates for d1zt9d1.
(The format of our PDB-style files is described here.)

Timeline for d1zt9d1: