Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (3 families) contains an extra shared helix after the HTH motif |
Family a.4.12.1: Trp repressor, TrpR [48296] (1 protein) intertwined dimer of identical 6-helical subunits |
Protein Trp repressor, TrpR [48297] (1 species) |
Species Escherichia coli [TaxId:562] [48298] (13 PDB entries) |
Domain d1zt9a1: 1zt9 A:5-105 [125631] automatically matched to d1co0a_ complexed with so4, trp |
PDB Entry: 1zt9 (more details), 2 Å
SCOP Domain Sequences for d1zt9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt9a1 a.4.12.1 (A:5-105) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} spysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg emsqrelknelgagiatitrgsnslkaapvelrqwleevll
Timeline for d1zt9a1: