![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries) Uniprot P01887 |
![]() | Domain d1zt7d1: 1zt7 D:1-99 [125630] Other proteins in same PDB: d1zt7a1, d1zt7a2, d1zt7c1, d1zt7c2 automatically matched to d1bz9b_ |
PDB Entry: 1zt7 (more details), 3 Å
SCOPe Domain Sequences for d1zt7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt7d1 b.1.1.2 (D:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1zt7d1: