Lineage for d1zt7d1 (1zt7 D:1-99)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) 
Protein beta2-microglobulin [88600] (4 species) 
Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries) 
Domain d1zt7d1: 1zt7 D:1-99 [125630]
automatically matched to d1bz9b_
Details for d1zt7d1
PDB Entry: 1zt7 (more details), 3 Å
PDB Description: crystal structure of class i mhc h-2kk in complex with a nonapeptide
PDB Compounds: (D:) Beta-2-microglobulinSCOP Domain Sequences for d1zt7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zt7d1 b.1.1.2 (D:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d1zt7d1:
Click to download the PDB-style file with coordinates for d1zt7d1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zt7d1:
- d1zt7d1 is new in SCOP 1.73
- d1zt7d1 appears in SCOP 1.75
- d1zt7d1 appears in the current release, SCOPe 2.08
View in 3D
