Lineage for d1zt7b1 (1zt7 B:1-99)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932586Domain d1zt7b1: 1zt7 B:1-99 [125629]
    Other proteins in same PDB: d1zt7a1, d1zt7a2, d1zt7c1, d1zt7c2
    automatically matched to d1bz9b_

Details for d1zt7b1

PDB Entry: 1zt7 (more details), 3 Å

PDB Description: crystal structure of class i mhc h-2kk in complex with a nonapeptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1zt7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt7b1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1zt7b1:

Click to download the PDB-style file with coordinates for d1zt7b1.
(The format of our PDB-style files is described here.)

Timeline for d1zt7b1: