Lineage for d1zt1b1 (1zt1 B:2-99)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784282Domain d1zt1b1: 1zt1 B:2-99 [125623]
    Other proteins in same PDB: d1zt1a1, d1zt1a2
    automatically matched to d1bz9b_
    complexed with cl

Details for d1zt1b1

PDB Entry: 1zt1 (more details), 2.5 Å

PDB Description: crystal structure of class i mhc h-2kk in complex with an octapeptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOP Domain Sequences for d1zt1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zt1b1 b.1.1.2 (B:2-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws
fyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1zt1b1:

Click to download the PDB-style file with coordinates for d1zt1b1.
(The format of our PDB-style files is described here.)

Timeline for d1zt1b1: