SCOP 1.73: Domain d1zsha1: 1zsh A:6-175

Lineage for d1zsha1 (1zsh A:6-175)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin [81291] (1 protein)

6. Protein Arrestin [49244] (2 species)
   duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head

7. Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (4 PDB entries)

8. Domain d1zsha1: 1zsh A:6-175 [125606]
   automatically matched to d1g4ma1
   complexed with ihp, mg

Details for d1zsha1

PDB Entry: 1zsh, 2.9 Å

PDB Description: crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (ip6)

PDB Compounds: (A:) beta-arrestin 1

SCOP Domain Sequences for d1zsha1:

Sequence; same for both SEQRES and ATOM records:

>d1zsha1 b.1.18.11 (A:6-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
trvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygr
edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

Timeline for d1zsha1:

• d1zsha1 is new in SCOP 1.73
  
• d1zsha1 appears in SCOP 1.75
  
• d1zsha1 appears in the current release, SCOPe 2.08