Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (185 PDB entries) Uniprot P61769 21-119 Uniprot P01884 Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d1zs8f1: 1zs8 F:1-99 [125597] Other proteins in same PDB: d1zs8a1, d1zs8a2, d1zs8c1, d1zs8c2, d1zs8e1, d1zs8e2, d1zs8g1, d1zs8g2, d1zs8i1, d1zs8i2 automatically matched to d1a9bb_ complexed with nag |
PDB Entry: 1zs8 (more details), 3 Å
SCOP Domain Sequences for d1zs8f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs8f1 b.1.1.2 (F:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1zs8f1: