SCOPe 2.05: Domain d1zs5a_: 1zs5 A:

Lineage for d1zs5a_ (1zs5 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)

8. Domain d1zs5a_: 1zs5 A: [125589]
   automated match to d1zs5a1
   complexed with mib

Details for d1zs5a_

PDB Entry: 1zs5

PDB Description: structure-based evaluation of selective and non-selective small molecules that block hiv-1 tat and pcaf association

PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d1zs5a_:

Sequence; same for both SEQRES and ATOM records:

>d1zs5a_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

Timeline for d1zs5a_:

• d1zs5a_ first appeared in SCOP 1.73, called d1zs5a1
  
• d1zs5a_ appears in SCOPe 2.04
  
• d1zs5a_ is called d1zs5a2 in SCOPe 2.06
  
• d1zs5a_ appears in the current release, SCOPe 2.08, called d1zs5a2