Lineage for d1zrea1 (1zre A:138-207)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1258793Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins)
  6. 1258794Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1258795Species Escherichia coli [TaxId:562] [46798] (24 PDB entries)
  8. 1258826Domain d1zrea1: 1zre A:138-207 [125539]
    Other proteins in same PDB: d1zrea2, d1zreb2
    automated match to d1i5zb1
    protein/DNA complex; complexed with cmp

Details for d1zrea1

PDB Entry: 1zre (more details), 2.8 Å

PDB Description: 4 crystal structures of cap-dna with all base-pair substitutions at position 6, cap-[6g;17c]icap38 dna
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d1zrea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zrea1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d1zrea1:

Click to download the PDB-style file with coordinates for d1zrea1.
(The format of our PDB-style files is described here.)

Timeline for d1zrea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrea2