Lineage for d1zq1c3 (1zq1 C:5-276,C:408-456)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872298Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 872299Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 872500Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
    N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively
  6. 872508Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE [143815] (2 species)
  7. 872512Species Pyrococcus abyssi [TaxId:29292] [143817] (1 PDB entry)
    Uniprot Q9V0U0 5-276,408-456
  8. 872513Domain d1zq1c3: 1zq1 C:5-276,C:408-456 [125495]
    Other proteins in same PDB: d1zq1a1, d1zq1a2, d1zq1b1, d1zq1b2, d1zq1c1, d1zq1c2, d1zq1d1, d1zq1d2
    complexed with asp

Details for d1zq1c3

PDB Entry: 1zq1 (more details), 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi
PDB Compounds: (C:) Glutamyl-tRNA(Gln) amidotransferase subunit E

SCOP Domain Sequences for d1zq1c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq1c3 d.128.1.5 (C:5-276,C:408-456) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Pyrococcus abyssi [TaxId: 29292]}
tdkfnyeelglkvgleihrqldtkklfspvpselsdkveftfqrrlrptmselgeidpaa
leefkkgrvyvyegnyeltdlvymdeepprgpdrealevalqiayllnakpvdevyymrk
ividgsnvsgfqrtaiiatdgkvetpwgavgipticleedaariierkdkeviyrldrlg
iplieisttpdihhpeqakvvakfigdalratkkvkrglgtirqdlnvsikggarieikg
vqeldmipiiiereverqlnllkirdelrkrgXpeetrralpdgnteymrplpgkarmyp
etdipplripddlkkkikenlp

SCOP Domain Coordinates for d1zq1c3:

Click to download the PDB-style file with coordinates for d1zq1c3.
(The format of our PDB-style files is described here.)

Timeline for d1zq1c3: