Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily) consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5 Domain 2 has parallel beta-sheet of 4 strands, order 1234 |
Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) |
Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins) automatically mapped to Pfam PF00710 |
Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [142776] (2 species) |
Species Pyrococcus abyssi [TaxId:29292] [142777] (1 PDB entry) Uniprot Q9V0T9 76-438 |
Domain d1zq1b2: 1zq1 B:76-438 [125492] Other proteins in same PDB: d1zq1a1, d1zq1b1, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3 automated match to d1zq1a2 complexed with asp |
PDB Entry: 1zq1 (more details), 3 Å
SCOPe Domain Sequences for d1zq1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq1b2 c.88.1.1 (B:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} kpevhfealiegkpglpevtiigtggtiasridyetgavypaftaeelakalpeifevan vkpkllfnifsedmkpkhwvkiahevakalnsgdygvvvahgtdtmgytaaalsfmlrnl gkpvvlvgaqrssdrpssdaamnlicsvrmatsevaevmvvmhgetgdtyclahrgtkvr kmhtsrrdafrsindvpiakiwpngeieflrkdyrkrsdeevevddkieekvalvkvypg isseiidflvdkgykgiviegtglghtpndiipsieraveegvavcmtsqciygrvnlnv ystgrkllkagvipcedmlpetayvklmwvlghtqnleevrkmmltnyageitpytrfdt ylr
Timeline for d1zq1b2: