SCOPe 2.07: Domain d1zq1b1: 1zq1 B:2-75

Lineage for d1zq1b1 (1zq1 B:2-75)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.3: GatD N-terminal domain-like [141300] (2 families)

5. Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein)
   PfamB PB010580

6. Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species)

7. Species Pyrococcus abyssi [TaxId:29292] [141303] (1 PDB entry)
   Uniprot Q9V0T9 2-75

8. Domain d1zq1b1: 1zq1 B:2-75 [125491]
   Other proteins in same PDB: d1zq1a2, d1zq1b2, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3
   automated match to d1zq1a1
   complexed with asp

Details for d1zq1b1

PDB Entry: 1zq1, 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi

PDB Compounds: (B:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d1zq1b1:

Sequence; same for both SEQRES and ATOM records:

>d1zq1b1 b.38.3.1 (B:2-75) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]}
rvdeflkerninvgdfvritkeedgeevtyegyimppyelsagdtlvlklengynigial
ekirrievlerakv

Timeline for d1zq1b1:

• d1zq1b1 first appeared in SCOP 1.73
  
• d1zq1b1 appears in SCOPe 2.06
  
• d1zq1b1 appears in the current release, SCOPe 2.08