Lineage for d1zq1a2 (1zq1 A:76-438)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911318Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2911319Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2911320Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins)
    automatically mapped to Pfam PF00710
  6. 2911588Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [142776] (2 species)
  7. 2911591Species Pyrococcus abyssi [TaxId:29292] [142777] (1 PDB entry)
    Uniprot Q9V0T9 76-438
  8. 2911592Domain d1zq1a2: 1zq1 A:76-438 [125490]
    Other proteins in same PDB: d1zq1a1, d1zq1b1, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3
    complexed with asp

Details for d1zq1a2

PDB Entry: 1zq1 (more details), 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d1zq1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]}
kpevhfealiegkpglpevtiigtggtiasridyetgavypaftaeelakalpeifevan
vkpkllfnifsedmkpkhwvkiahevakalnsgdygvvvahgtdtmgytaaalsfmlrnl
gkpvvlvgaqrssdrpssdaamnlicsvrmatsevaevmvvmhgetgdtyclahrgtkvr
kmhtsrrdafrsindvpiakiwpngeieflrkdyrkrsdeevevddkieekvalvkvypg
isseiidflvdkgykgiviegtglghtpndiipsieraveegvavcmtsqciygrvnlnv
ystgrkllkagvipcedmlpetayvklmwvlghtqnleevrkmmltnyageitpytrfdt
ylr

SCOPe Domain Coordinates for d1zq1a2:

Click to download the PDB-style file with coordinates for d1zq1a2.
(The format of our PDB-style files is described here.)

Timeline for d1zq1a2: