![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.3: GatD N-terminal domain-like [141300] (2 families) ![]() |
![]() | Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein) PfamB PB010580 |
![]() | Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species) |
![]() | Species Pyrococcus abyssi [TaxId:29292] [141303] (1 PDB entry) Uniprot Q9V0T9 2-75 |
![]() | Domain d1zq1a1: 1zq1 A:2-75 [125489] Other proteins in same PDB: d1zq1a2, d1zq1b2, d1zq1c1, d1zq1c2, d1zq1c3, d1zq1d1, d1zq1d2, d1zq1d3 complexed with asp |
PDB Entry: 1zq1 (more details), 3 Å
SCOPe Domain Sequences for d1zq1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq1a1 b.38.3.1 (A:2-75) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} rvdeflkerninvgdfvritkeedgeevtyegyimppyelsagdtlvlklengynigial ekirrievlerakv
Timeline for d1zq1a1: