Lineage for d1zpqc1 (1zpq C:3-80)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768280Family a.35.1.9: Bacteriophage CII protein [140520] (1 protein)
    Pfam PF05269; a compact helix-swapped dimer of the canonical fold; includes the extra C-terminal teramerisation region (alpha-helix); in the tetramer-DNA complex only two of the four HTH motifs interact with DNA
  6. 768281Protein Regulatory protein cII [140521] (1 species)
  7. 768282Species Bacteriophage lambda [TaxId:10710] [140522] (3 PDB entries)
    Uniprot P03042 2-80! Uniprot P03042 4-81
  8. 768293Domain d1zpqc1: 1zpq C:3-80 [125471]
    automatically matched to 1XWR A:2-80

Details for d1zpqc1

PDB Entry: 1zpq (more details), 2.8 Å

PDB Description: structure of bacteriophage lambda cii protein
PDB Compounds: (C:) Regulatory protein CII

SCOP Domain Sequences for d1zpqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpqc1 a.35.1.9 (C:3-80) Regulatory protein cII {Bacteriophage lambda [TaxId: 10710]}
rankrnealriesallnkiamlgtektaeavgvdksqisrwkrdwipkfsmllavlewgv
vdddmarlarqvaailtn

SCOP Domain Coordinates for d1zpqc1:

Click to download the PDB-style file with coordinates for d1zpqc1.
(The format of our PDB-style files is described here.)

Timeline for d1zpqc1: