Lineage for d1zp5a_ (1zp5 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529842Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 2529843Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries)
  8. 2529862Domain d1zp5a_: 1zp5 A: [125455]
    automated match to d1i73a_
    complexed with 2ni, ca, zn

Details for d1zp5a_

PDB Entry: 1zp5 (more details), 1.8 Å

PDB Description: crystal structure of the complex between mmp-8 and a n-hydroxyurea inhibitor
PDB Compounds: (A:) Neutrophil collagenase

SCOPe Domain Sequences for d1zp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zp5a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOPe Domain Coordinates for d1zp5a_:

Click to download the PDB-style file with coordinates for d1zp5a_.
(The format of our PDB-style files is described here.)

Timeline for d1zp5a_: