SCOP 1.73: Domain d1zoqc1: 1zoq C:2065-2111

Lineage for d1zoqc1 (1zoq C:2065-2111)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
   3 helices, non-globular array; forms interlocked heterodimers with its targets

4. Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family)
   not a true superfamily

5. Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (2 proteins)

6. Protein Nuclear receptor coactivator CBP/p300 ibid domain [69127] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69128] (4 PDB entries)

8. Domain d1zoqc1: 1zoq C:2065-2111 [125453]
   automatically matched to d1kbhb_

Details for d1zoqc1

PDB Entry: 1zoq, 2.37 Å

PDB Description: IRF3-CBP complex

PDB Compounds: (C:) creb-binding protein

SCOP Domain Sequences for d1zoqc1:

Sequence; same for both SEQRES and ATOM records:

>d1zoqc1 a.153.1.1 (C:2065-2111) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus) [TaxId: 10090]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

Timeline for d1zoqc1:

• d1zoqc1 is new in SCOP 1.73
  
• d1zoqc1 appears in SCOP 1.75
  
• d1zoqc1 appears in the current release, SCOPe 2.08, called d1zoqc_