Lineage for d1zola_ (1zol A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167118Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2167119Protein beta-Phosphoglucomutase [75174] (3 species)
  7. 2167120Species Lactococcus lactis [TaxId:1358] [75175] (17 PDB entries)
  8. 2167134Domain d1zola_: 1zol A: [125452]
    automated match to d1lvha_
    complexed with mg

Details for d1zola_

PDB Entry: 1zol (more details), 1.9 Å

PDB Description: native beta-PGM
PDB Compounds: (A:) beta-phosphoglucomutase

SCOPe Domain Sequences for d1zola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zola_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}
mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk

SCOPe Domain Coordinates for d1zola_:

Click to download the PDB-style file with coordinates for d1zola_.
(The format of our PDB-style files is described here.)

Timeline for d1zola_: