SCOP 1.75: Domain d1znqp2: 1znq P:152-315

Lineage for d1znqp2 (1znq P:152-315)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Human(Homo sapiens), liver isoform [TaxId:9606] [143535] (2 PDB entries)
   Uniprot P04406 151-314

8. Domain d1znqp2: 1znq P:152-315 [125404]
   Other proteins in same PDB: d1znqo1, d1znqp1, d1znqq1, d1znqr1
   automatically matched to 1ZNQ O:152-315
   complexed with nad

Details for d1znqp2

PDB Entry: 1znq, 2.5 Å

PDB Description: crystal structure of human liver gapdh

PDB Compounds: (P:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOP Domain Sequences for d1znqp2:

Sequence; same for both SEQRES and ATOM records:

>d1znqp2 d.81.1.1 (P:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]}
cttnclaplakvihdnfgiveglmttvhaitatqktvdgpsgklwrdgrgalqniipast
gaakavgkvipelngkltgmafrvptanvsvvdltcrlekpakyddikkvvkqasegplk
gilgytehqvvssdfnsdthsstfdagagialndhfvkliswyd

Timeline for d1znqp2:

• d1znqp2 first appeared in SCOP 1.73
  
• d1znqp2 appears in SCOPe 2.01
  
• d1znqp2 appears in the current release, SCOPe 2.08