SCOP 1.73: Domain d1znqp1: 1znq P:3-151,P:316-335

Lineage for d1znqp1 (1znq P:3-151,P:316-335)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)

7. Species Human(Homo sapiens), liver isoform [TaxId:9606] [141915] (2 PDB entries)

8. Domain d1znqp1: 1znq P:3-151,P:316-335 [125403]
   Other proteins in same PDB: d1znqo2, d1znqp2, d1znqq2, d1znqr2
   automatically matched to 1ZNQ O:3-151,O:316-335
   complexed with nad

Details for d1znqp1

PDB Entry: 1znq, 2.5 Å

PDB Description: crystal structure of human liver gapdh

PDB Compounds: (P:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOP Domain Sequences for d1znqp1:

Sequence; same for both SEQRES and ATOM records:

>d1znqp1 c.2.1.3 (P:3-151,P:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]}
kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
apsadapmfvmgvnhekydnslkiisnasXnefgysnrvvdlmahmaske

Timeline for d1znqp1:

• d1znqp1 is new in SCOP 1.73
  
• d1znqp1 appears in SCOP 1.75
  
• d1znqp1 appears in the current release, SCOPe 2.08