![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
![]() | Protein Response regulatory protein StyR, C-terminal domain [140317] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [140318] (2 PDB entries) Uniprot O30989 131-200 |
![]() | Domain d1zn2a1: 1zn2 A:131-200 [125371] Other proteins in same PDB: d1zn2a2 automated match to d1yioa1 complexed with mg |
PDB Entry: 1zn2 (more details), 2.91 Å
SCOPe Domain Sequences for d1zn2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zn2a1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} etqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhnimqklnvrsl anlvhlveky
Timeline for d1zn2a1: