Lineage for d1zn1a1 (1zn1 A:1-185)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1030942Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 1030987Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 1030988Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 1030989Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 1030992Species Escherichia coli [TaxId:562] [64292] (5 PDB entries)
  8. 1030996Domain d1zn1a1: 1zn1 A:1-185 [125370]
    automatically matched to d1ek8a_
    protein/RNA complex

Details for d1zn1a1

PDB Entry: 1zn1 (more details), 14.1 Å

PDB Description: coordinates of rrf fitted into cryo-em map of the 70s post-termination complex
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1zn1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zn1a1 d.67.3.1 (A:1-185) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]}
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

SCOPe Domain Coordinates for d1zn1a1:

Click to download the PDB-style file with coordinates for d1zn1a1.
(The format of our PDB-style files is described here.)

Timeline for d1zn1a1: