SCOPe 2.05: Domain d1zn0a1: 1zn0 A:1-185

Lineage for d1zn0a1 (1zn0 A:1-185)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families)
   automatically mapped to Pfam PF01765

5. Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)

6. Protein Ribosome recycling factor, RRF [55196] (7 species)

7. Species Escherichia coli [TaxId:562] [64292] (5 PDB entries)

8. Domain d1zn0a1: 1zn0 A:1-185 [125369]
   automatically matched to d1ek8a_
   protein/RNA complex

Details for d1zn0a1

PDB Entry: 1zn0, 15.5 Å

PDB Description: Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both EF-G (GDPNP) and RRF

PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1zn0a1:

Sequence; same for both SEQRES and ATOM records:

>d1zn0a1 d.67.3.1 (A:1-185) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]}
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

Timeline for d1zn0a1:

• d1zn0a1 first appeared in SCOP 1.73
  
• d1zn0a1 appears in SCOPe 2.04
  
• d1zn0a1 appears in SCOPe 2.06
  
• d1zn0a1 appears in the current release, SCOPe 2.08