SCOPe 2.05: Domain d1zm9f_: 1zm9 F:

Lineage for d1zm9f_ (1zm9 F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (5 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186856] (4 PDB entries)

8. Domain d1zm9f_: 1zm9 F: [125353]
   Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9c1, d1zm9c2, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9e1, d1zm9e2, d1zm9e3, d1zm9e4, d1zm9e5
   automated match to d1aera_
   complexed with p34

Details for d1zm9f_

PDB Entry: 1zm9, 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34

PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d1zm9f_:

Sequence; same for both SEQRES and ATOM records:

>d1zm9f_ d.166.1.1 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

Timeline for d1zm9f_:

• d1zm9f_ first appeared in SCOP 1.73, called d1zm9f1
  
• d1zm9f_ appears in SCOPe 2.04
  
• d1zm9f_ appears in SCOPe 2.06
  
• d1zm9f_ appears in the current release, SCOPe 2.08