Lineage for d1zm9e3 (1zm9 E:561-725)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636637Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1636638Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 1636639Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
    Uniprot P32324
  8. 1636657Domain d1zm9e3: 1zm9 E:561-725 [125350]
    Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a4, d1zm9a5, d1zm9b_, d1zm9c1, d1zm9c2, d1zm9c4, d1zm9c5, d1zm9d_, d1zm9e1, d1zm9e2, d1zm9e4, d1zm9e5, d1zm9f_
    automated match to d1n0vc3
    complexed with p34

Details for d1zm9e3

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm9e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9e3 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d1zm9e3:

Click to download the PDB-style file with coordinates for d1zm9e3.
(The format of our PDB-style files is described here.)

Timeline for d1zm9e3: